PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_34A0848F2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 355aa    MW: 38790.7 Da    PI: 4.8471
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_34A0848F2.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.6e-171663148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT+eEd +l+ +++q+G  +W++ ++  g+ R++k+c++rw +yl
  Traes_2BL_34A0848F2.1 16 RGSWTPEEDMRLIAYIQQYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                           89******************************99************97 PP

2Myb_DNA-binding56.18.5e-1869114148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T eE+e l++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Traes_2BL_34A0848F2.1  69 RGNFTVEEEETLIKLHNMLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                            89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-23766IPR009057Homeodomain-like
PROSITE profilePS5129414.7981163IPR017930Myb domain
SuperFamilySSF466891.57E-3013110IPR009057Homeodomain-like
SMARTSM007173.6E-131565IPR001005SANT/Myb domain
PfamPF002493.3E-151663IPR001005SANT/Myb domain
CDDcd001671.78E-101863No hitNo description
PROSITE profilePS5129424.94564118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2667118IPR009057Homeodomain-like
SMARTSM007176.7E-1668116IPR001005SANT/Myb domain
PfamPF002494.1E-1669114IPR001005SANT/Myb domain
CDDcd001678.00E-1271114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNRGSWT PEEDMRLIAY IQQYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTVEEEETL IKLHNMLGNK WSKIAACLPG RTDNEIKNVW NTHLKKRVAA  120
SAGEQKKGGA KSKKKTTCVD VPVPSPSPSS STTTTTTTTN CSSGESGEQS NTIKELEFEM  180
DKIEIPMLDL GFDLDMLLNA VPDTHFPAIS SASTSPCSSA SPPCVVDDQV LLDLPEIDIM  240
PELWSIMDGE GGVGACAETA QAPWSNAALC QGNGTEASAA TANEDDDGKE WWLEDLEKDL  300
GLWGPIEDYQ LQQPDPQGRV DPFSASVDDS ASCYFPAHTV RHFFSRVRQG GTILL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2486490.0AK248649.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf178a22, mRNA sequence.
GenBankAK3696890.0AK369689.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2095N02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006653723.11e-140PREDICTED: myb-related protein Zm1-like
SwissprotP200241e-105MYB1_MAIZE; Myb-related protein Zm1
TrEMBLW5B8K90.0W5B8K9_WHEAT; Uncharacterized protein
STRINGMLOC_53640.11e-165(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-68myb domain protein 63
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]